DPCstruct | MC40150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1473 |
|---|---|
| Mean domain length (aa) | 83 ± 15 aa |
| Standard deviation of domain lengths | 14.63 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 98.36 |
| Assigned Pfam label(s) | CL0187- CL0244- PF14107- PF11860- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5YNW5 | 11-79 | RKVNLKLGSKGVDVGVVQKFLNIYNGTSKRIDNDFGAGTVTLVKDFQKDIGLTADGEVGSTTLNKMINW |
| A0A1C0V7E3 | 16-92 | RSGVPASDQVVSDILRLGDRGNLVQVVQHELNMRGFDAGQPDGMFGPQTEIAVKQAQSAYGLTPDGIVGADTWERLG |
| A0A6J4LAZ5 | 140-208 | None |
| A0A7T5EWK3 | 228-303 | None |
| A0A3M2HIH5 | 133-220 | None |
| A0A1Z3HTC3 | 188-260 | None |
| A0A3D1R919 | 21-122 | None |
| A0A1F6VJ15 | 28-116 | None |
| A0A3M1H1R2 | 50-119 | None |
| A0A6M6DZK0 | 67-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.