DPCstruct | MC4015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 164 ± 32 aa |
| Standard deviation of domain lengths | 31.82 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369K820 | 1-142 | MNSWGRPLSPPILRDAPSVGNADLETNKAAFPWYYGEDAGGHIFTFGENYGKKVRDTSLSYLYAIGGMPASHPGVLPVRRFCSGVRE… |
| A8N8F6 | 21-177 | AEPREKSPAPLGVGPLPDGGPFGGPGDPNDPEYNPDHPLYWRFGTNAGGMILRMKKHYGERMNNVPYKYLKWCYKNLKFALTFRKAF… |
| A0A6G1J6A3 | 1-228 | None |
| A0A4Y7QKG8 | 1-151 | None |
| A0A067PTW9 | 5-134 | None |
| A0A0D7AWF2 | 1-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.