DPCstruct | MC40149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 188 ± 29 aa |
| Standard deviation of domain lengths | 29.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0V299 | 20-203 | GSEEHHPDLRLFGIALFLVAEAMIFLGLFAAYLTFRSVAPSWPPEGTPKLELLLPGINTLILISSSFVIHKGDDAIRANDVKGMRLW… |
| A0A7C2C4J1 | 467-661 | WALEDEYSHPVEHHTVTGKSNAWMGMAWFIVSEVGLFAVLIAGYLYLRLSGHAVPPAERPALWLALLNTFFLVSSSFTVHFAHHDLR… |
| A0A6V8D4T2 | 57-282 | None |
| A0A3A5FX18 | 8-193 | None |
| A0A5N6P2K7 | 279-485 | None |
| A0A445HQS0 | 42-261 | None |
| A0A5A7R0C5 | 55-265 | None |
| A0A7G4JQC0 | 16-212 | None |
| A0A7Y4UKN6 | 9-210 | None |
| A0A3M1WES3 | 35-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.