DPCstruct | MC40148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 151 ± 26 aa |
| Standard deviation of domain lengths | 25.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11371 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0UXM2 | 2-148 | VAILAGVFILGMGVGIGFSSSASVDPQNVASREFIDRAAPNPELCAQFGASAISMNARIFVTLSPFSVYVSQPEMQPGCVMRSNNWA… |
| Q05S65 | 12-117 | GLLAIAPPAINSASAQDQFCQQFGAEAVITTSKVFVTTMPASTFVAKPEAQRGCVIRRKHWAELRRGHHITPAQESHCSKPSNTFAY… |
| Q063L1 | 2-118 | None |
| A0A7R9WGK2 | 23-169 | None |
| A0A0H3K063 | 36-186 | None |
| A0A7S2T1Z5 | 38-217 | None |
| A0A7R9Y439 | 109-280 | None |
| A9SV01 | 263-439 | None |
| A0A7I4FDQ3 | 148-294 | None |
| A0A1Y1IB30 | 55-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.