DPCstruct | MC40147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 154 ± 29 aa |
| Standard deviation of domain lengths | 28.68 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08853 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0UVI8 | 14-139 | TVALPDGFPDRLPSLTIELLWDILDDRLEDDRVNQLLWHGLGYQWDPNTQAWLAPADWQGDYPEPPNFIESRPATVKLTRSIPAENK… |
| A0A844GVJ0 | 6-116 | PPLTNETIWDILGEKIDDETVNKLVWYHLGYRYNHESQTWDNSKVEDSWKKEYPIPPDFIANRPPNVKLTRSIPKEKKQLLKKKLGF… |
| A0A6S9ADJ1 | 106-268 | None |
| A0A7S2MEP5 | 31-253 | None |
| L1IPH5 | 5-164 | None |
| A0A7J7IPT7 | 45-176 | None |
| A0A7S0CNA4 | 32-228 | None |
| A0A7S3SRL2 | 16-162 | None |
| A0A5J4Z449 | 49-239 | None |
| A0A7R9US55 | 50-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.