DPCstruct | MC40142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 215 ± 23 aa |
| Standard deviation of domain lengths | 23.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9ELD2 | 1-243 | MDPHLRTDRVATPSPLAAGDLLARHLADPRAGWSVGVWGGIAEFQYDEGEAVTFIDGGRGAVTARGGIRLARDVAPRALELRRTGSD… |
| A0A2G6EHI1 | 62-296 | AGQRLPWTTDDTRRFVAESLGRGTGTWVMGVVGAVAEFAPAPGEAVSVTVEDDTVTAHTRGGALRMIINDDVRALTFDQPTDDGKAR… |
| A0A5B2YZJ2 | 7-226 | None |
| A0A552UGA9 | 5-245 | None |
| A0A7W6QSG7 | 56-249 | None |
| A0A0S9Q8I1 | 7-180 | None |
| A0A1F4AHV6 | 1-215 | None |
| A0A2E5PK68 | 20-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.