DPCstruct | MC4014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 8.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3DQP0 | 208-331 | SSNDPEPVNVNTEHENTPPIERMDIVAQVAVLIGVVCNIIMGVSQCSGNFIIGTLSLLLSLAFQQSDGRLSASHENIIQQLPPTMEA… |
| A0A369K6G0 | 21-144 | IFPQVHIYESSIAKLDIIAQMMILLGAVCHIIVGLSTEPCNSILSIVTMIIKMAMATRLPKHGNAKSDYDPNQHAILKQLPTSLFTA… |
| F4RYZ1 | 1-121 | None |
| A0A180GC73 | 28-147 | None |
| A0A6A4H072 | 213-340 | None |
| A0A6A4GZC3 | 327-444 | None |
| A0A6A4GE12 | 273-379 | None |
| A0A0C3NCD0 | 1-116 | None |
| B0DT47 | 65-163 | None |
| A0A284QRN9 | 241-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.