DPCstruct | MC40135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 152 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6BJ76 | 2-152 | RKLITYLNKKYKIYLVGLEKSGSFVEHAEQIRKKIPSKHFLLLGNKYIYKYIIPSIKNDDPYGCSSYYSHKLIFKSENNNMYVVSIP… |
| A0A1D2XDQ3 | 303-471 | RPMQRLIHATNSKLKSLGQLPMMMIGIQKQGVVAEHAQMIRKYLPRDHFRFVDDEYRNRFLSPVKDEQIFGYETYYGQDLIYHTERG… |
| A0A6L8HDK3 | 103-241 | None |
| A0A1F4X1T7 | 125-277 | None |
| A0A4U7BQA6 | 10-172 | None |
| A0A4P7UA88 | 177-336 | None |
| A0A0Q7IGC8 | 1-141 | None |
| A0A7V4J6N8 | 71-231 | None |
| A0A7W0JFU2 | 58-212 | None |
| A0A0U3MRN0 | 180-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.