DPCstruct | MC40133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 8.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9SNG7 | 2-124 | KNFKFLILLLFVISNNYFSYSQFYNGLQMGFGKNRVQYGDFYWSFFRFDRFDTYYYVNGKELAEYTSKFAYKKIEEIENKFEYRLEK… |
| A0A660Q0B1 | 11-118 | RPALFLTVVVFAVLFALPANAQFYFGRNKVQYDNFDWQMMTTEHFHLYFYTEEEEVAQTAAHLAESAYRELAVKFNHEIDKKIPLII… |
| A0A1W9RKX3 | 5-131 | None |
| A0A2T2V5B1 | 2-112 | None |
| A0A3A0BGF1 | 38-152 | None |
| A0A6M1T7R8 | 2-113 | None |
| A0A6J4TT98 | 1-122 | None |
| A0A7Y3IE16 | 1-114 | None |
| A0A538TSQ8 | 12-124 | None |
| A0A7D3X5Z3 | 8-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.