DPCstruct | MC40131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 280 ± 59 aa |
| Standard deviation of domain lengths | 59.30 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.60 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF17804- PF08180- CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9SL45 | 32-294 | KNKFLISLVLSSLENYHFEPKDINDDFAEKVFKTYVLQLDYNKRLLLQSDVDKLEKIKYQIDDEIKDGNSNFFEISYSIAEKRLKNV… |
| A0A379S3G6 | 18-214 | QHATVSERVTSRFTRSHYRQFDLDQAFSAKIFDRYLNLLDYSHNVLLASDVEQFAKKKTVLGDELRTGKLDVFYDLYNLAQKRRFER… |
| A0A848X2Y8 | 8-330 | None |
| A0A3S4FSD2 | 2-268 | None |
| A0A6I1J1Y8 | 44-278 | None |
| A0A0M3CAD2 | 29-311 | None |
| A0A388PF56 | 5-306 | None |
| A0A5C6A0C7 | 190-487 | None |
| A0A6N4WSL4 | 1-400 | None |
| A0A1G3QCV0 | 3-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.