DPCstruct | MC4013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 217 |
|---|---|
| Mean domain length (aa) | 228 ± 47 aa |
| Standard deviation of domain lengths | 46.62 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369K0Q4 | 19-243 | HTPLLESPLLPHEHRYSGKYDGFLERLTEVPLDILFEIFSHLHPLDLLRLARTTKTLRSILMQRSATSVWKATISNVDGLPPCPPDL… |
| A0A165Z9S8 | 4-181 | LPPESLAKWARVNRAFRDTVLHNESLWRNVLALVPGLPACPQELKPIDYARLIFGHWCFQCKKSRVGVSIFELRVRLCDDCQLNLET… |
| A0A2N0Q160 | 70-328 | None |
| A0A3N4IM44 | 136-351 | None |
| S7QI32 | 4-175 | None |
| E4V3I3 | 27-227 | None |
| A0A4U0VWZ0 | 1-207 | None |
| A0A2H3EDC1 | 96-252 | None |
| M2MZA6 | 1-219 | None |
| A0A0H2SN77 | 1-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.