DPCstruct | MC40129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 89 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2MIS6 | 1-75 | MESTLTTKGQITLPKALRAALHLKSGDKIIFEVLENGEYILKPKTQDVRVLKGCISYKGKPKSIEDMQSAISKAV |
| A0A1G1P7Y2 | 1-89 | MAISKMVRNGQITIPAKIRKTLHIQDGDLVRFDVHNNQLIVTPVSIIDKDQAYFFSEKWQKAIKTSEKAVQEGKYTAYSSAKDLKKD… |
| A0A7C7QRW8 | 2-85 | None |
| A0A2H9T9H8 | 33-110 | None |
| G0JSB0 | 48-143 | None |
| A0A6I1ENM4 | 1-80 | None |
| A0A7X0EIA7 | 6-99 | None |
| A0A523CH67 | 1-94 | None |
| A0A4Q4X659 | 4-86 | None |
| A0A2M7AH59 | 17-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.