DPCstruct | MC40125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 573 ± 111 aa |
| Standard deviation of domain lengths | 111.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7MUB2 | 4-482 | TLNENYSLAWLQMSTISLFTLIGSLLTVLHFISTHVNASRSRIETVCESINTKSEQIFNAPQILLQASVNSVFTAKDNIHRSLSTAI… |
| A0A4T0IL48 | 19-480 | VQTALAAVTELVRLATSAIEDVAHSIGDLVSSAFDSANNAIDTINDLISWSGESVGHIEAPSLDALNNFEMPASVQDTLNEANENLP… |
| A0A7D9H345 | 17-566 | None |
| A0A177TJ96 | 10-876 | None |
| A0A068SDJ5 | 1-564 | None |
| A0A376B5X2 | 8-675 | None |
| A0A395IF14 | 2-412 | None |
| B5VQD6 | 1-473 | None |
| A0A060SXX3 | 19-661 | None |
| A0A1Q2YBU0 | 2-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.