DPCstruct | MC40123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 402 ± 59 aa |
| Standard deviation of domain lengths | 59.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11709 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B5L8W4 | 8-361 | IRIKQVDSIENVTDFASAADHSLSLEKFQELRVAMSIPRSKELRLFSASSKRTDLWPVSVFEEDRDFTDPRGGKEDDDKRWKFRGPW… |
| A0A5M8Q215 | 8-400 | IRVDAVDSIDHITDFRSSADHVLTLRKWQEMDIPISIPEPPRKPTASSFSQATIGPPRSVFEAQVDNTELTQQNTGIDQQRWKYKGP… |
| A0A0E9NC19 | 59-475 | None |
| M5FY59 | 1-470 | None |
| A0A166GHZ9 | 2-390 | None |
| A0A137Q3B7 | 368-855 | None |
| A0A4S4KPS3 | 15-301 | None |
| A0A1B9GRL0 | 1-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.