DPCstruct | MC40122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 333 ± 46 aa |
| Standard deviation of domain lengths | 45.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 80.83 |
| Assigned Pfam label(s) | CL0123- PF15784 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0FN72 | 36-394 | DQLVNYTVKDRQLKGISFDPPDPTLEFNNEQVNDRPVEMLELQYTDSNLETFHSLTSQVLQQHDQIKDKVREYMIFRNQARSQKIEG… |
| A0A2G9S3Y9 | 1-207 | MFSLLQEQNICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEII… |
| R8BCN8 | 176-493 | None |
| A0A368FQ56 | 1-322 | None |
| T1EFD1 | 1-276 | None |
| A0A5J4YNW7 | 33-352 | None |
| A0A5J4Z6I7 | 59-405 | None |
| A0A835RFQ6 | 250-535 | None |
| A0A6A4VJL7 | 258-620 | None |
| A0A0N5ABE4 | 17-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.