DPCstruct | MC40121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2MLA6 | 7-112 | AVRARDALFALSADLPRDEWWRYLASAKAAGVDKEVAREWSAQSERYNASDFEATWRSFKPEGGIGPGTLFKMAMDAGWRDPRARNV… |
| A0A2N2U4N7 | 9-104 | PELMRSALAHIPANLPRDEWARVGMAIKSEYADGTGFDLFDAWSASDVDRYDKKAVTSTWRSIKAGGGVAVATLLHLAKEHGFTLPK… |
| A0A1Y6D883 | 10-106 | None |
| A0A1S8KRM4 | 6-111 | None |
| A0A1M5AQR7 | 3-139 | None |
| A0A011QSX9 | 200-320 | None |
| A0A378XND5 | 3-101 | None |
| A0A845Z357 | 203-316 | None |
| E4ZCJ2 | 3-93 | None |
| A0A391P913 | 6-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.