DPCstruct | MC40117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 20.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 33.24 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0172- PF09812 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7UEK9 | 7-171 | FHATSFLSASPMKKKRVELDPNKAKKRIRKIEKAIRKLESKGRKFKPINEIEGDRSVLRTQSSRLRETEALSFDEAESRALLIKRWS… |
| A0A803V3A5 | 2-132 | KKKLKKLEKAAPELIPIEDFITPLKYSESSRMRSLPALSPQESERRVLLLKKWCLFKQKQDEAEKKAIKGLVESQQEALRELRLESE… |
| A0A5J4NIG6 | 1-176 | None |
| A0A2A3E928 | 13-171 | None |
| A0A6I9W709 | 3-166 | None |
| A0A2P2I0F7 | 21-203 | None |
| T1K1U0 | 2-182 | None |
| A0A4W2I0L5 | 19-200 | None |
| A0A2G8LKI0 | 31-194 | None |
| A0A654HVT8 | 20-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.