DPCstruct | MC4011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 137 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6LHZ1 | 394-529 | EAPVLYDLMCDTWAAVDGLGRELPDAAACGAPRTDRSVGIFYWTWHRDELGPYDNTKLTANARDGIVSWPPCTSHWWGESEYGYYRA… |
| A0A2S7TY70 | 16-150 | ALILSFLLWNLSGAEWLRGEDFTRPSNNWVATDALGRHLPVHRETGDRRPGKFVGIFYFVWVGNHTPKVYDITKILKVPEEERQWGP… |
| A0A661GV69 | 310-430 | None |
| A0A1V5Z0S8 | 14-160 | None |
| A0A1V5W3M6 | 4-149 | None |
| A0A661WV85 | 329-457 | None |
| A0A7C6HH72 | 5-139 | None |
| A0A316RYU4 | 272-412 | None |
| R5IGE3 | 7-159 | None |
| A0A814JZ58 | 14-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.