DPCstruct | MC40107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 83 ± 16 aa |
| Standard deviation of domain lengths | 15.59 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251SDU9 | 1-73 | MGKAKKRWTSEEEAALSAGVYKYGTGKWKDILNDHQFAHCLINRSNVDLKDKWRNLGCNASNSQGSSRRHTGS |
| A0A835MDH2 | 1-60 | MGNPKQKWTSEEEEALRAGVAKHGTGKWKNIQRDPEFNPYLYSRSNIDLKVFLSFLFFLF |
| A0A5N5I8H6 | 65-125 | None |
| A0A199VQT2 | 1-76 | None |
| A0A061RED4 | 1-84 | None |
| A0A165A2J3 | 37-99 | None |
| A0A444XDF5 | 186-241 | None |
| A0A445JGS8 | 1-76 | None |
| A0A6P5FBF3 | 1-91 | None |
| A0A0D3DLJ9 | 90-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.