DPCstruct | MC40102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 47.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834AMJ5 | 1-110 | MQLVPDIEFKITYTRSPDGDGVGNSYIEDNDDDSKMADLLSYFQQQLTVQESLLKLCQPELESSQTHISVLPMEVLMYIFRWVVSSD… |
| A0A2H8TUT4 | 51-159 | KKIADEDFTSRSSMNPTDDNNLSDECDDEYDNKEDLFLRFQRIMGPQICFPEQTQLNTHFSALPPELVLYIFRWVVSYDLDLRMLEQ… |
| A0A653DVZ8 | 40-162 | None |
| A0A7J5Y006 | 102-221 | None |
| G5B5V4 | 305-409 | None |
| A0A6I8R3V9 | 100-201 | None |
| A0A820DZQ4 | 294-414 | None |
| A0A815CMU2 | 108-229 | None |
| G2HIT3 | 80-184 | None |
| A0A3B5LUT8 | 105-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.