DPCstruct | MC40100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834ADW7 | 1-98 | MDSRKKLNKFLENPELYVPPLAPHPLPPADMIPKRLTLSELKKRFPKCAELQGYCPVTYQDGNQRYEALVPGNIKYAIEYRDRIYIC… |
| A0A672P335 | 56-163 | LAAEFRGHFYKMTSREFLERFLESPEQFVAPGCPYPLPPPPLLPHKLSAGQVKSRFPQQVEMKGFCPVTYLDGQQRYEALVRGNTEY… |
| A0A5K4F5L6 | 1689-1801 | None |
| A0A139ATQ0 | 3-122 | None |
| A0A815IR48 | 1-98 | None |
| G1MD71 | 1000-1112 | None |
| S7NMC2 | 1109-1231 | None |
| A0A3P8I3R0 | 301-413 | None |
| A0A7J7JLV5 | 134-244 | None |
| A0A0R3X5R1 | 431-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.