DPCstruct | MC4010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4CMY5 | 8-108 | EERLGWLSPSGDFYPCGWGAHSTEAERILSELGLFEDFLRHSILNVRDYLSGRGYCLIHSPGRERKLVTHLLPLTRAQRDFLYDYFT… |
| A0A416JNB1 | 2-112 | ELCGFLAGDGTFTFCECWQHVASAQKLVQETYGEYLTGIRAENFLMEQGYVVYYANSVQHRFCIGFGAKSRMMLLTAEQKDFIVANL… |
| A0A373PSK3 | 156-259 | None |
| A0A1Y4GWG7 | 90-186 | None |
| A0A3A9A922 | 40-142 | None |
| A0A316L649 | 170-284 | None |
| A0A1C6JRQ3 | 63-177 | None |
| A0A255IK41 | 42-141 | None |
| A0A2N5IAG4 | 67-185 | None |
| A0A1C5T4M3 | 141-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.