DPCstruct | MC401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 178 ± 16 aa |
| Standard deviation of domain lengths | 16.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5BA51 | 55-216 | TDSEESGDSIRLLQGSTKGTRRKRRTQRSTSSAFNPDDVDTEVKITWCNDNQNFCGNVCLNMTWGAPINDGCDSENLQWHCTCGNGK… |
| A0A1X7RZJ8 | 96-274 | TTQPPINFKMRSFIVVAALSAIASAQNYSVGANGQLMIDASQISTGERQSWCLGQRNNCPKVCEGPANPNSCDSNTLEWTCTCTNGN… |
| A0A2K1QZM7 | 1-146 | None |
| A0A2U3EEJ9 | 544-701 | None |
| A0A1B8E5R2 | 14-194 | None |
| A0A507CY24 | 1-179 | None |
| A0A6A5YG93 | 28-222 | None |
| R1GC84 | 1-190 | None |
| A0A6A5W5K9 | 42-221 | None |
| A0A0B4H7J1 | 4-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.