DPCstruct | MC40092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7I8R0 | 1-79 | DNQLVVFADDTTPRYVTCVCVLDYHTVAVADKFGNLAVVRLPEKVNEDVQDDPTVSKSVWDRGWLNGASQKVANEALVY |
| A0A0F8B2I4 | 735-813 | NKLIPFADDSINRWSTCSALVDYESVAGGDKFGNFWIVRAPVKDSEEADEDPSGTHLLHTRGYLHGTPARLSCMVHFYT |
| A0A4U6U747 | 38-131 | None |
| A0A2I3H7V7 | 197-290 | None |
| A0A6F8ZSD0 | 774-867 | None |
| B3KQH1 | 699-794 | None |
| A0A565BVM9 | 257-349 | None |
| A0A6N2MM10 | 78-150 | None |
| A0A0G4GYE2 | 381-482 | None |
| A0A251U821 | 88-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.