DPCstruct | MC40088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 294 ± 45 aa |
| Standard deviation of domain lengths | 45.19 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.61 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | PF06276- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3SGF9 | 6-277 | SRRTADVASTHTLLGCVAREVAGPERQTTLADGHAVVRLPRSAVLLRCAVARVSEVGAHRYEGPVQRFSGGVWSPVDAAGLAALVAD… |
| A0A4D4LBS3 | 13-346 | DLWDRAGRLLIRKALAEFTHERLLAPELGPDGRYAVTSDDGAVTYRFAARVLSLDHWLVETDSITRHDRTGTELPLDALDFFIELRG… |
| A0A815NXI2 | 10-290 | None |
| A0A2G1C4B8 | 217-476 | None |
| A0A7Y5XRP2 | 554-884 | None |
| D3BU25 | 38-402 | None |
| A0A429F000 | 444-727 | None |
| A0A7V7KH12 | 30-285 | None |
| A0A0F7M168 | 3-200 | None |
| A0A828B601 | 11-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.