DPCstruct | MC4008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6PCW1 | 170-282 | ERSEITFTVAECGEFHSLGRYRDDISNAEEAIEVWKEYQKGTLNGIPSIGIQIHKPGQPEVEDMQVDLVSGKTMDLDMLRYYSEINV… |
| A0A1H9UKT3 | 4-107 | LVTLSVYECSEFHSMGEVHEGIKSVDEAIRVWNSIPSSRMNGIKSIAIVLGEGWDATEFEAVIGKTMDLEMLRYYSDIASNQKAISM… |
| A0A7X3MCU4 | 688-800 | None |
| A0A6L5X366 | 935-1049 | None |
| A0A355TLM6 | 294-399 | None |
| A0A374X302 | 4-113 | None |
| A0A2X2UQ50 | 7-133 | None |
| A0A2N5Q022 | 573-685 | None |
| A0A174U5P4 | 3-109 | None |
| A0A7X3SM30 | 240-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.