DPCstruct | MC40079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 213 ± 33 aa |
| Standard deviation of domain lengths | 32.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259N9A2 | 56-287 | KVFLDRAASLIAKYDIYEQDHMKRGNKALYECMEYTYDYALDVFNSPLKEDILDAMRWRTKNTTGKMPSASTPPMTLIVKYVFGDTD… |
| A0A191UHB5 | 10-251 | VLSAQSIVEKADALVKQRESFEQNEYARSNQRLYEILAEVLDMYEQASSSKTTLAETVKQLKTKLEASKVRVQTNTLALTLFVRYVF… |
| A0A2T7SQ90 | 51-278 | None |
| D6V4B5 | 46-240 | None |
| F6IKL0 | 14-191 | None |
| F3L407 | 38-245 | None |
| A0A1F4I2T2 | 11-221 | None |
| A0A259PLJ5 | 13-273 | None |
| A0A2K1G5Z2 | 99-289 | None |
| C4ZJA7 | 36-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.