DPCstruct | MC40077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 326 ± 80 aa |
| Standard deviation of domain lengths | 79.65 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2PPY7 | 17-346 | YSYSINTTSPESSERAKMIAALVKLKAAALLQQFVRDVVTSTYDGSENAALLTSVRVLGDVDAAAVLSALVGARMPHRPSACADLLL… |
| A0A4P2PXD3 | 126-473 | SWAVDELASRVEAGATDEARDRAKELLPFWRRVAPNEASEAFVRDLLSVAVALDDGELAFGLLSPLGPHRLSPRTTPAFVTLVQHYG… |
| A0A4Z1IKH6 | 117-615 | None |
| A0A7M5XA81 | 252-591 | None |
| A0A7M5XH36 | 601-954 | None |
| A0A146HW08 | 99-490 | None |
| A0A067BXY7 | 323-633 | None |
| A0A067BY65 | 350-672 | None |
| A0A146HNM2 | 25-376 | None |
| A0A538Q9D2 | 202-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.