DPCstruct | MC40073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 7.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3DZA0 | 4-56 | GQVPVTVELLAPSRRPVQVTQDLEGFWRRHYPQIRRELMRRYPRHAWPEDPYN |
| W4U8B8 | 98-154 | VCDGRVRVVLHLLSPARRPLAVTDDLASFWASVYPAVRVENRGRYSKHPWPEDPMTA |
| A0A1Q2Z0T1 | 227-291 | None |
| A0A6J7ERN5 | 150-202 | None |
| A0A7S2S986 | 51-126 | None |
| A0A484WV00 | 92-162 | None |
| A0A3M3PBF5 | 645-713 | None |
| A0A3M0A8K1 | 716-788 | None |
| A0A377CVP9 | 83-153 | None |
| H6SRG5 | 471-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.