DPCstruct | MC40072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 97 ± 3 aa |
| Standard deviation of domain lengths | 2.62 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2RFE4 | 282-378 | HLSPLKSMSEDYRFENDEGDYWAVRFATSQFESAKSVKQVFDLVVYYLCNIEISVSEKMGHLTVREDDDNGEPGITHNRLVSVTGKG… |
| K3X389 | 58-152 | FLDPLKSHISDERFENAQGDYCCVWFDTIQFENVKSVKQVFDAFVFYLLSMEISITERLGNLTIRDDYDFVHDNTMSSYRLLSKESG… |
| A0A2P4WY42 | 165-261 | None |
| A0A0W8C7M5 | 20-116 | None |
| K3X392 | 47-150 | None |
| D0NKC1 | 104-198 | None |
| H3GVZ5 | 54-150 | None |
| A0A6A3IFL3 | 202-299 | None |
| W2W358 | 58-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.