DPCstruct | MC40069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06399 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0XAH0 | 11-98 | DMTYVLLEYHPYTQKATVGDSDSDPRLMHFLDAVIEQGPGCEMEYRTTMKPRLILNKLETRGYKVVAMTSTCTGSGGLVSTSWTLRRK |
| M7BUY1 | 1-67 | MVGDEHSDQHLMDYLGAIKRNMLGNHFWEYYVNDAPRIVLDKLEKYGYRVVSMTGVGQTLVWCLHKE |
| A0A3P8NHS1 | 86-176 | None |
| A0A6A4KDG7 | 2-102 | None |
| A0A6A4JVK2 | 1-82 | None |
| A0A1I8HYR1 | 1-86 | None |
| A0A2R7VUJ4 | 31-115 | None |
| A0A815KYX3 | 1-82 | None |
| A0A811ZJH1 | 1-72 | None |
| A0A6P8GEX6 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.