DPCstruct | MC40057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5CIP9 | 2-65 | MAERLGIHASSFNGWVLGEHGDTSVPVWSGANVAGVNLQKLNPDIGTEGDKEQWKATHKAVVDR |
| A0A821T337 | 135-203 | SARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHRQVV |
| A0A7M3R3A0 | 67-135 | None |
| A0A310SLV6 | 404-477 | None |
| A0A401S4X8 | 128-187 | None |
| A0A368G6U3 | 3-71 | None |
| A0A654GJB7 | 85-143 | None |
| A0A2G3AP40 | 143-223 | None |
| B4H195 | 335-403 | None |
| A0A6V7HH35 | 79-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.