DPCstruct | MC40056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 118 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5CBQ9 | 42-163 | REAQRLSLRYAKCTKYEIQSAIKVVLSWTISVNCITAALSALSLYNMSTGDKFSRGKSVRCGLVFSVGKFFRWMVDSRVALRIHEHA… |
| A0A7S4MJY0 | 1-106 | TNKASLTAREIQTSTRLVLIGELAKHAVSEGTKAITKYNSSETTGVARSTKAGLLFPVGRIHRYLKERTKLRIASIAPVYLTAVVEY… |
| A0A1A8JU15 | 21-150 | None |
| A0A3S2UJ91 | 81-205 | None |
| A0A7N8YG41 | 126-239 | None |
| A0A7R9HRV1 | 667-782 | None |
| A0A3P7KXC3 | 219-331 | None |
| Q4SM72 | 128-253 | None |
| A0A4C1THR0 | 29-131 | None |
| W5KD98 | 128-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.