DPCstruct | MC4005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1DTL7 | 56-129 | IARVTAERHGAIRVGTPDELAQVARIFGACGMHPVGFYDLREANPPIPVVSTAFRPIDGAELAANPFRVFTSLL |
| A0A7G2IXS7 | 1-74 | MGTAQELSTLRRMFAVMGMYPVSYYDLSQAGVPVHSTAFRPIDDASLSRNPFRVFTSLLRLELIEKRRAAAKSR |
| A0A1E3BFM2 | 78-133 | None |
| A0A2S8BJ36 | 55-128 | None |
| X7YK09 | 52-125 | None |
| A0A4D4LM94 | 56-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.