DPCstruct | MC40049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 443 ± 47 aa |
| Standard deviation of domain lengths | 46.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.37 |
| Pfam Score | 89.17 |
| Assigned Pfam label(s) | CL0220- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1RIM2 | 3-414 | PLSQELAELLKESVKRSYGELDLGLPGGLGTGEWRHAALLQDSAPGAVASQHLNRRLRATLITDSELLTRILKAFEQCASDGAKLLK… |
| A0A7S1FB10 | 6-489 | PSASLLLRIRQAFCQCSGSVHSSIAPVELARYWQKLAEGEAKRQGRVFTATDSQAIALGVVQLVQEVDLTSTGRFTIDDWVHYMLLL… |
| A0A7J6QR21 | 362-856 | None |
| A0A7S4R0N5 | 45-504 | None |
| A0A7J6PDQ1 | 10-475 | None |
| A0A7S1FFX4 | 204-659 | None |
| A0A7S2I963 | 1-352 | None |
| A0A7J6R5S2 | 3-373 | None |
| A0A813G6Y4 | 9-535 | None |
| A0A7S4VX26 | 38-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.