DPCstruct | MC40045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 220 ± 40 aa |
| Standard deviation of domain lengths | 40.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6P1R6 | 56-269 | RRRGYSQAFGEDVALIREAKRATLDKGVPARSVANAGTDVQNLSIWLRQDNRGQIAGRLGQDSLVADVRDYINNGGGPRSVVSSVNK… |
| X6F831 | 28-201 | GKVKDGTVKRHVNSLFGFGRWLLENNRPGFAARLHDPSLDQDRKEYESRGGSWDVPRALGRLKTLAGGAPMVGRAVRNPDPVDAALI… |
| A0A0R3MIB3 | 14-207 | None |
| A0A7G6T599 | 318-496 | None |
| A0A1R1QPE3 | 14-230 | None |
| A0A1C3XJH2 | 77-390 | None |
| A0A650F6V2 | 1-289 | None |
| A0A6N7LHQ6 | 215-416 | None |
| A0A7W6XFN5 | 3-205 | None |
| A0A3M3AF47 | 46-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.