DPCstruct | MC4004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 23.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05661 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5QTQ3 | 2-127 | PIIKKITLGSLRNKLLIILPIGLLLTAVAPWLLPVALVIGGAYLCFEGGEKILERFGGAAHAEEESGPIDEAQIIRQAITTDFVLST… |
| A0A7G2IXH5 | 2-161 | LGDDLSLNAQQVSGVRANRELPVVWSVAKGSFVNKVILVPLALLISAFIPWAITPLLMVGGAFLCFEGVEKVLHTLEARKHKESPEE… |
| A0A1W1CKN7 | 1-188 | None |
| A0A7G3D6V8 | 2-130 | None |
| X8F6T6 | 25-145 | None |
| A0A6G3VNB2 | 2-129 | None |
| A0A6N8FDV4 | 18-179 | None |
| A0A7W0VQK9 | 1-186 | None |
| R4YBM1 | 4-172 | None |
| A0A014DS34 | 17-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.