DPCstruct | MC40031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 200 ± 50 aa |
| Standard deviation of domain lengths | 50.17 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 70.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9F8S5 | 22-198 | MDYKLLQLHKYEQSRKRAKFIDFAYHDNARVILPEENIYRFEFSSSPACLSIQLMDNGNEKAEMVAASIEPNFAAYLFNDFLSIVSS… |
| A0A428TE36 | 127-382 | IEEYITGDVDETRYQDVMRHYYLKAGWKVYTIQDLLKTLCRLALTCSSTDAKEKTPDLIQQYIASREKEETSYQTEISARKFAEKCV… |
| B0D7Z4 | 144-296 | None |
| Q54UJ3 | 1681-1910 | None |
| A0A1D6LIT2 | 4-153 | None |
| A0A5A7PI73 | 204-362 | None |
| A0A4Y9ZIM9 | 487-674 | None |
| A0A3Q0F122 | 350-550 | None |
| A0A2P2MR99 | 4-177 | None |
| D3B0Z1 | 1000-1160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.