DPCstruct | MC4003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 290 ± 79 aa |
| Standard deviation of domain lengths | 79.04 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0123- PF00309 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2INX0 | 1-321 | MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNPLLEQTDLHDEIDTQEKQDSETLDTADALEQKEMPEELPLDAS… |
| A0A7V4H263 | 3-155 | LVAGTSLQEHLLEQVRLSELDEKQRAIAELIVGNVDERGYLQSGLEEIAFSAGVPVEQVAEVLRVVQTFNPPGVAARDLRECLLLQL… |
| A0A136JQT2 | 1-305 | None |
| A0A1F9VRG5 | 16-372 | None |
| A0A1W9VSH8 | 1-231 | None |
| D0R1X8 | 1-202 | None |
| A0A257UKR5 | 274-664 | None |
| A0A7Z9G8J4 | 1-316 | None |
| A0A4P1AUS4 | 1-203 | None |
| A0A834M8X5 | 1-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.