DPCstruct | MC40028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4Q8A2 | 73-179 | VRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPKTCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEP… |
| A0A7C9EWM9 | 26-112 | SLFRFDEKLISATDRHRQSTDHPIKFISRRQPKIPKFKIKPGPEAGSLDARTKKISSFLFHPNLPLVISIQQTMFFQSPVVNIHFRR |
| A0A388KXY9 | 1058-1183 | None |
| A0A7E4RW72 | 410-514 | None |
| A0A7J8N693 | 162-252 | None |
| A0A507F8F5 | 447-539 | None |
| Q550K3 | 1311-1423 | None |
| A0A453I7J7 | 129-213 | None |
| A0A7J5YYZ6 | 348-454 | None |
| A0A7J8CIW8 | 85-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.