DPCstruct | MC40024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 7 aa |
| Standard deviation of domain lengths | 6.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 41.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3PF93 | 52-164 | YNSYFSFSRGRSGYSGVATYCKDSATPFAAEEGLTGLLTNHEGAVGCYGDQKDFSSEELQPLDNEGRAVITQHRIMCGEKEKMVTVI… |
| A0A7C9EJL4 | 1-113 | ALPISFCRVKAAFSSIEVALPVAAEEGFTGVLEGSRGTESRNCYAFADAECLREFQTDDLLKIDGEGRCIITDHAHFVLFNIYGPRA… |
| A0A445EUY8 | 55-177 | None |
| M7YDN0 | 56-185 | None |
| R1D5X1 | 90-202 | None |
| R1BNL6 | 294-406 | None |
| A0A0D2LX61 | 1-128 | None |
| A0A150GNH8 | 57-178 | None |
| A0A1D6IA15 | 56-183 | None |
| A0A3Q7G534 | 55-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.