DPCstruct | MC40022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 56.17 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF02536- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5VPY5 | 210-326 | MGFEVRWLVQYPEFLGVNLDKWIIPRHNVVEHLKSVGGLGDPVEMKHYVRLSRRRFYNMFVKPYPECEKIFGGLVREREEMVRQGHP… |
| A0A7C9EGU2 | 1-99 | VHFDKQITPRHNVIKYLRSKGGLGFEVGLRDIIKPSRLKFYNFYVKPYPECEEMFGRFSDYVETKPRHPAGLWKVFKPSKYPESKED… |
| J3NDI5 | 1-103 | None |
| A0A7J6E813 | 322-428 | None |
| A0A0A9UEB8 | 1-117 | None |
| A0A835IP79 | 35-131 | None |
| G7IIZ3 | 79-175 | None |
| A0A5D2XSR7 | 156-270 | None |
| A0A835I320 | 130-218 | None |
| A0A0B2QH84 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.