DPCstruct | MC40021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 232 ± 39 aa |
| Standard deviation of domain lengths | 38.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9EBN1 | 36-260 | LHIEPMNQDFSATPLDDRLEADDCAQPHANGYGSISESISWPQDAKTIQDEVAPSKEEFPPSPSDEQSILVSLSSRCVWKGTVCERS… |
| A0A2I0L5N2 | 1-173 | MVSSKEEFPPSSSDHQSILVSLSTRCVWKGTVCERAHLFRIKYYGSFDKPLGRYLQDHLFDQNYRCRSCELPSEAHVHCYTHRQGSL… |
| A0A453DLS0 | 35-328 | None |
| A0A835RTB7 | 177-428 | None |
| A0A314YNI3 | 328-602 | None |
| J9FJD7 | 136-322 | None |
| A0A453I032 | 323-537 | None |
| A0A6G0TQI3 | 882-1077 | None |
| A0A482T4J2 | 193-376 | None |
| A0A4P1RSI1 | 191-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.