DPCstruct | MC4002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 48 ± 2 aa |
| Standard deviation of domain lengths | 1.85 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 62.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365VR37 | 29-74 | FTAQSWEQGCALCGSRTSYLDEIVTDDAGSRMFVCSDTDYCQREKQ |
| A0A7G2ILI9 | 1-48 | MQSWDEPCAICGSTHSYLDEVVLDDSGKRMFVCSDTDYCRQQSEALSK |
| A0A3M5F1Q7 | 350-398 | None |
| A0A377E091 | 388-437 | None |
| A0A7H4PD99 | 37-86 | None |
| A0A853ME21 | 57-100 | None |
| A0A2X2XH36 | 58-107 | None |
| A0A1Q9US23 | 214-262 | None |
| H1SI02 | 632-679 | None |
| A0A6I7PB88 | 507-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.