DPCstruct | MC40018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 505 ± 62 aa |
| Standard deviation of domain lengths | 62.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A210PME2 | 508-962 | AILLTVFVHYQELSAINCMTLFCFVVMVTRVFANEIRPDATVKEIMTNLGLLSLSVMANISPLLFILASYLFQGNASGADATGIGFI… |
| A0A7C9EA37 | 3-543 | ILTCLYASKLAMLFISSKSIIWISAVLLLAVSPPLLLYKDKSRTAAKMKPWQGYMHAFVISLAVWFCREAIFECLQWWQGRAPSDGL… |
| A0A6J8EEY9 | 237-704 | None |
| A0A7S3FLK5 | 11-487 | None |
| A0A6J0PMZ0 | 77-705 | None |
| A4S6I8 | 451-988 | None |
| A0A2K3NWV8 | 100-600 | None |
| A0A7S0PL58 | 1-448 | None |
| A0A2V2V0Z5 | 359-867 | None |
| A0A7S0I968 | 546-1108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.