DPCstruct | MC40013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 8.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 23.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9JHJ9 | 3-85 | ASVAQVGHAEQVCDSRDVLAASLIDWYGETLQVEVAGPAGRVEIWASDQTGTWSRVRVDTARGVACVIETGDGWDGQPAGGVP |
| A0A8B3LPQ0 | 12-85 | AISAFPAVPALAAQCAARADMIKALGEKFHESEAARGLVNPSLILEIFVSDQGTWTILATDTHGQSCVITAGEG |
| A0A7L9WKK2 | 102-191 | None |
| A0A516H2A2 | 11-100 | None |
| A0A2P7S8J9 | 21-111 | None |
| A0A1D9M9G2 | 18-102 | None |
| A0A2H6AZU9 | 15-97 | None |
| A0A357VC66 | 249-322 | None |
| A0A2E3BFK1 | 29-104 | None |
| A0A1P8V027 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.