DPCstruct | MC4001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 71 ± 13 aa |
| Standard deviation of domain lengths | 13.45 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.85 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0143- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377ZL56 | 1-62 | MNNWPNPFIEQRADPFILRHLSHYYFIASVPEYDRLEIRRAVTLEGLRDAEPVVVWRAPQSG |
| A0A2V1NQ87 | 1-62 | MNPLVLHRADPQALRHTDGHYYFTATHPQYDRIVLRRSRTLEGLAEAPESVIWNAHPTGDMA |
| A0A373A8N3 | 4-61 | None |
| E2LLY5 | 22-74 | None |
| A0A413LW83 | 16-70 | None |
| A0A0K6GAP5 | 717-808 | None |
| A0A364MWJ2 | 453-533 | None |
| A0A7X0NPK9 | 18-82 | None |
| A0A5B0DKS7 | 475-536 | None |
| A0A4U6X700 | 119-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.