DPCstruct | MC40009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 160 ± 23 aa |
| Standard deviation of domain lengths | 22.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.13 |
| Pfam Score | 99.36 |
| Assigned Pfam label(s) | PF01814- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536VWL8 | 3-168 | TVRKPAAKMDAIAMLIADHKKVQKAFKDFEKLKEGGSKRGRSDIVRQTCADLTVHTMIEEEIFYPAARKAIKDMDVMDEATVEHAGA… |
| A0A7W5MR39 | 42-184 | VFAGPWDEALAAEHAAALKLFDALEKTDEKATKRRTLLLAQLKHSIAKHAFQEENVVYAEMRDHGLTEGADQLNHEHGYVKQYFFEL… |
| G8TTP9 | 1-149 | None |
| A0A2D6PT34 | 2-154 | None |
| A0A1M2ZJS4 | 32-206 | None |
| A0A0D2MI25 | 68-230 | None |
| A0A1Q8YI37 | 24-143 | None |
| A0A086ME42 | 7-163 | None |
| A0A2V7XTN0 | 9-154 | None |
| Q1AWR3 | 75-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.