DPCstruct | MC40004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 242 ± 22 aa |
| Standard deviation of domain lengths | 21.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357TJ31 | 2-215 | LEAETADGWQKLDFPVGAPVGKTKTILVDLEGKLPANTTRLRLSMAFEIHWNRIALLEKTTLPNATEQHAAATDLHWHGYGAFENQP… |
| A0A3N5Z2V0 | 252-474 | QAERVVLLLTAWIDYADSSSNLAASQAGAKLVPPYLQIVDQQGSWVTVLDNMGFPAGLPKTMTVDLTGKLLNKQDPRVKIVTSMRIY… |
| A0A660VMJ4 | 858-1112 | None |
| A0A7X7TB73 | 5-255 | None |
| A0A7W1W4Y4 | 42-288 | None |
| A0A2N3FHS8 | 823-1065 | None |
| A0A2N3FH07 | 404-644 | None |
| A0A5C6AT36 | 1004-1256 | None |
| A0A3D0MJY5 | 2-227 | None |
| A0A7W2AUJ8 | 136-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.