DPCstruct | MC40003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 17.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A511GRM2 | 1-100 | MILLAGLAACSPYAPAQRDEHELALAGFTAHFADTTARWQMMSLLPPQRLTYRMSNLGPLMLYADPLACGCVYFGDRKAYRAYTMLH… |
| A0A258K383 | 2-84 | LAAAGFRVKIADTPDKVASLKKLPPHKFTVQNQGGQPVYLYADPTVCGCLYYGTQDNFANYQQMMFQQRLVNEQQMTAMMNQQ |
| A0A2V5ZGW4 | 7-93 | None |
| A0A3D0IAF2 | 13-108 | None |
| A0A2V6IZI7 | 15-110 | None |
| A0A1H8VHH9 | 11-124 | None |
| A0A2M6ZL03 | 25-145 | None |
| A0A090KN55 | 20-126 | None |
| A0A090KNC5 | 8-110 | None |
| A0A2V2RM92 | 21-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.